Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary

Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Russian team 11. Russian team 4 pts. 9,341
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 9,334
  3. Avatar for CHNO Junkies 13. CHNO Junkies 2 pts. 9,215
  4. Avatar for Kangwon_National_University_Computers_in_Chemistry 14. Kangwon_National_University_Computers_in_Chemistry 1 pt. 8,823
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,807
  6. Avatar for Team Canada 16. Team Canada 1 pt. 7,988
  7. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 7,633
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 7,199
  9. Avatar for Trinity Biology 19. Trinity Biology 1 pt. 7,134
  10. Avatar for Italiani Al Lavoro 20. Italiani Al Lavoro 1 pt. 2,801
  1. Avatar for MrZanav 51. MrZanav Lv 1 22 pts. 10,097
  2. Avatar for Lotus23 52. Lotus23 Lv 1 21 pts. 10,058
  3. Avatar for alwen 53. alwen Lv 1 20 pts. 10,051
  4. Avatar for John McLeod 54. John McLeod Lv 1 20 pts. 10,044
  5. Avatar for Deleted player 55. Deleted player 19 pts. 10,043
  6. Avatar for wboler 56. wboler Lv 1 18 pts. 10,041
  7. Avatar for knotartist 57. knotartist Lv 1 18 pts. 10,000
  8. Avatar for fishercat 58. fishercat Lv 1 17 pts. 9,981
  9. Avatar for FractalCuber 59. FractalCuber Lv 1 16 pts. 9,978
  10. Avatar for jausmh 60. jausmh Lv 1 16 pts. 9,924

Comments