Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since over 5 years ago

Intermediate Overall Prediction

Summary


Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 2,801

  1. Avatar for Migi
    1. Migi Lv 1
    100 pts. 10,767
  2. Avatar for Xartos 2. Xartos Lv 1 98 pts. 10,716
  3. Avatar for KarenCH 3. KarenCH Lv 1 95 pts. 10,622
  4. Avatar for johnmitch 4. johnmitch Lv 1 93 pts. 10,620
  5. Avatar for robgee 5. robgee Lv 1 90 pts. 10,570
  6. Avatar for BootsMcGraw 6. BootsMcGraw Lv 1 88 pts. 10,550
  7. Avatar for malphis 7. malphis Lv 1 86 pts. 10,545
  8. Avatar for grogar7 8. grogar7 Lv 1 83 pts. 10,544
  9. Avatar for Polarstern 9. Polarstern Lv 1 81 pts. 10,538
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 79 pts. 10,531

Comments