Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,785
  2. Avatar for Go Science 2. Go Science 78 pts. 10,734
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,674
  4. Avatar for Contenders 4. Contenders 45 pts. 10,550
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,449
  6. Avatar for Beta Folders 6. Beta Folders 24 pts. 10,443
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,375
  8. Avatar for Marvin's bunch 8. Marvin's bunch 12 pts. 10,351
  9. Avatar for Rechenkraft.net 9. Rechenkraft.net 8 pts. 9,907
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 9,739

  1. Avatar for WBarme1234 41. WBarme1234 Lv 1 31 pts. 10,240
  2. Avatar for xythus 42. xythus Lv 1 30 pts. 10,228
  3. Avatar for christioanchauvin 43. christioanchauvin Lv 1 29 pts. 10,222
  4. Avatar for marsfan 44. marsfan Lv 1 28 pts. 10,185
  5. Avatar for g_b 45. g_b Lv 1 27 pts. 10,184
  6. Avatar for donuts554 46. donuts554 Lv 1 26 pts. 10,175
  7. Avatar for Phyx 47. Phyx Lv 1 25 pts. 10,166
  8. Avatar for Hustvedt 48. Hustvedt Lv 1 24 pts. 10,147
  9. Avatar for Blipperman 49. Blipperman Lv 1 23 pts. 10,116
  10. Avatar for ZeroLeak7 50. ZeroLeak7 Lv 1 23 pts. 10,109

Comments