Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,785
  2. Avatar for Go Science 2. Go Science 78 pts. 10,734
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,674
  4. Avatar for Contenders 4. Contenders 45 pts. 10,550
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,449
  6. Avatar for Beta Folders 6. Beta Folders 24 pts. 10,443
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,375
  8. Avatar for Marvin's bunch 8. Marvin's bunch 12 pts. 10,351
  9. Avatar for Rechenkraft.net 9. Rechenkraft.net 8 pts. 9,907
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 9,739

  1. Avatar for MrZanav 51. MrZanav Lv 1 22 pts. 10,097
  2. Avatar for Lotus23 52. Lotus23 Lv 1 21 pts. 10,058
  3. Avatar for alwen 53. alwen Lv 1 20 pts. 10,051
  4. Avatar for John McLeod 54. John McLeod Lv 1 20 pts. 10,044
  5. Avatar for Deleted player 55. Deleted player 19 pts. 10,043
  6. Avatar for wboler 56. wboler Lv 1 18 pts. 10,041
  7. Avatar for knotartist 57. knotartist Lv 1 18 pts. 10,000
  8. Avatar for fishercat 58. fishercat Lv 1 17 pts. 9,981
  9. Avatar for FractalCuber 59. FractalCuber Lv 1 16 pts. 9,978
  10. Avatar for jausmh 60. jausmh Lv 1 16 pts. 9,924

Comments