Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,785
  2. Avatar for Go Science 2. Go Science 78 pts. 10,734
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,674
  4. Avatar for Contenders 4. Contenders 45 pts. 10,550
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,449
  6. Avatar for Beta Folders 6. Beta Folders 24 pts. 10,443
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,375
  8. Avatar for Marvin's bunch 8. Marvin's bunch 12 pts. 10,351
  9. Avatar for Rechenkraft.net 9. Rechenkraft.net 8 pts. 9,907
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 9,739

  1. Avatar for versat82 61. versat82 Lv 1 15 pts. 9,907
  2. Avatar for georg137 62. georg137 Lv 1 15 pts. 9,905
  3. Avatar for alcor29 63. alcor29 Lv 1 14 pts. 9,882
  4. Avatar for Hellcat6 64. Hellcat6 Lv 1 13 pts. 9,809
  5. Avatar for OWM3 65. OWM3 Lv 1 13 pts. 9,766
  6. Avatar for heather-1 66. heather-1 Lv 1 12 pts. 9,764
  7. Avatar for Todd6485577 67. Todd6485577 Lv 1 12 pts. 9,739
  8. Avatar for Anfinsen_slept_here 68. Anfinsen_slept_here Lv 1 12 pts. 9,701
  9. Avatar for cbwest 69. cbwest Lv 1 11 pts. 9,685
  10. Avatar for Superphosphate 70. Superphosphate Lv 1 11 pts. 9,675

Comments