Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,785
  2. Avatar for Go Science 2. Go Science 78 pts. 10,734
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,674
  4. Avatar for Contenders 4. Contenders 45 pts. 10,550
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,449
  6. Avatar for Beta Folders 6. Beta Folders 24 pts. 10,443
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,375
  8. Avatar for Marvin's bunch 8. Marvin's bunch 12 pts. 10,351
  9. Avatar for Rechenkraft.net 9. Rechenkraft.net 8 pts. 9,907
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 9,739

  1. Avatar for stomjoh 81. stomjoh Lv 1 7 pts. 9,343
  2. Avatar for kyoota 82. kyoota Lv 1 6 pts. 9,341
  3. Avatar for ShadowTactics 83. ShadowTactics Lv 1 6 pts. 9,334
  4. Avatar for jawz101 84. jawz101 Lv 1 6 pts. 9,311
  5. Avatar for pfirth 85. pfirth Lv 1 6 pts. 9,253
  6. Avatar for lraguette 86. lraguette Lv 1 5 pts. 9,241
  7. Avatar for allie_heather47 87. allie_heather47 Lv 1 5 pts. 9,232
  8. Avatar for Dolichwier 88. Dolichwier Lv 1 5 pts. 9,230
  9. Avatar for spdenne 89. spdenne Lv 1 5 pts. 9,216
  10. Avatar for pmlkjn 90. pmlkjn Lv 1 5 pts. 9,215

Comments