Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since over 5 years ago

Intermediate Overall Prediction

Summary

Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,785
  2. Avatar for Go Science 2. Go Science 78 pts. 10,734
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,674
  4. Avatar for Contenders 4. Contenders 45 pts. 10,550
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,449
  6. Avatar for Beta Folders 6. Beta Folders 24 pts. 10,443
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,375
  8. Avatar for Marvin's bunch 8. Marvin's bunch 12 pts. 10,351
  9. Avatar for Rechenkraft.net 9. Rechenkraft.net 8 pts. 9,907
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 9,739
  1. Avatar for spmm 21. spmm Lv 1 57 pts. 10,375
  2. Avatar for Timo van der Laan 22. Timo van der Laan Lv 1 56 pts. 10,367
  3. Avatar for fpc 23. fpc Lv 1 54 pts. 10,351
  4. Avatar for Galaxie 24. Galaxie Lv 1 53 pts. 10,335
  5. Avatar for MicElephant 25. MicElephant Lv 1 51 pts. 10,329
  6. Avatar for silent gene 26. silent gene Lv 1 49 pts. 10,321
  7. Avatar for Deleted player 27. Deleted player pts. 10,310
  8. Avatar for inhtih 28. inhtih Lv 1 47 pts. 10,299
  9. Avatar for phi16 29. phi16 Lv 1 45 pts. 10,299
  10. Avatar for guineapig 30. guineapig Lv 1 44 pts. 10,285

Comments