Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for CHNO Junkies 11. CHNO Junkies 2 pts. 9,340
  2. Avatar for Russian team 12. Russian team 1 pt. 9,312
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,308
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,264
  5. Avatar for Kangwon_National_University_Computers_in_Chemistry 15. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,034
  6. Avatar for Chem Eng Thermo 16. Chem Eng Thermo 1 pt. 8,791
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 8,143
  8. Avatar for Deleted group 18. Deleted group pts. 7,553
  1. Avatar for Jakki 91. Jakki Lv 1 6 pts. 9,190
  2. Avatar for jsfoldingaccount 92. jsfoldingaccount Lv 1 6 pts. 9,182
  3. Avatar for Arne Heessels 93. Arne Heessels Lv 1 5 pts. 9,175
  4. Avatar for Mohoernchen 94. Mohoernchen Lv 1 5 pts. 9,171
  5. Avatar for donuts554 95. donuts554 Lv 1 5 pts. 9,155
  6. Avatar for infjamc 96. infjamc Lv 1 5 pts. 9,146
  7. Avatar for CAN1958 97. CAN1958 Lv 1 4 pts. 9,125
  8. Avatar for rinze 98. rinze Lv 1 4 pts. 9,118
  9. Avatar for foobar23 99. foobar23 Lv 1 4 pts. 9,111
  10. Avatar for RWoodcock 100. RWoodcock Lv 1 4 pts. 9,097

Comments