Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Go Science 100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394

  1. Avatar for Xartos
    1. Xartos Lv 1
    100 pts. 9,744
  2. Avatar for Galaxie 2. Galaxie Lv 1 98 pts. 9,740
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 96 pts. 9,739
  4. Avatar for KarenCH 4. KarenCH Lv 1 93 pts. 9,737
  5. Avatar for pauldunn 5. pauldunn Lv 1 91 pts. 9,732
  6. Avatar for LociOiling 6. LociOiling Lv 1 89 pts. 9,728
  7. Avatar for diamonddays 7. diamonddays Lv 1 87 pts. 9,711
  8. Avatar for mirp 8. mirp Lv 1 84 pts. 9,706
  9. Avatar for grogar7 9. grogar7 Lv 1 82 pts. 9,678
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 80 pts. 9,670

Comments