Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for CHNO Junkies 11. CHNO Junkies 2 pts. 9,340
  2. Avatar for Russian team 12. Russian team 1 pt. 9,312
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,308
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,264
  5. Avatar for Chem Eng Thermo 16. Chem Eng Thermo 1 pt. 8,791
  6. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 8,143
  7. Avatar for Deleted group 18. Deleted group pts. 7,553

  1. Avatar for GuR0 101. GuR0 Lv 1 4 pts. 9,091
  2. Avatar for Dolichwier 102. Dolichwier Lv 1 4 pts. 9,084
  3. Avatar for Pazithi 103. Pazithi Lv 1 3 pts. 9,072
  4. Avatar for zeluis 104. zeluis Lv 1 3 pts. 9,060
  5. Avatar for BarrySampson 105. BarrySampson Lv 1 3 pts. 9,059
  6. Avatar for Dhalion 106. Dhalion Lv 1 3 pts. 9,053
  7. Avatar for jawz101 107. jawz101 Lv 1 3 pts. 9,053
  8. Avatar for 201512809 108. 201512809 Lv 1 3 pts. 9,034
  9. Avatar for FractalCuber 109. FractalCuber Lv 1 3 pts. 9,032
  10. Avatar for skovz99 110. skovz99 Lv 1 3 pts. 9,030

Comments