Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for CHNO Junkies 11. CHNO Junkies 2 pts. 9,340
  2. Avatar for Russian team 12. Russian team 1 pt. 9,312
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,308
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,264
  5. Avatar for Kangwon_National_University_Computers_in_Chemistry 15. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,034
  6. Avatar for Chem Eng Thermo 16. Chem Eng Thermo 1 pt. 8,791
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 8,143
  8. Avatar for Deleted group 18. Deleted group pts. 7,553
  1. Avatar for xbp 131. xbp Lv 1 1 pt. 8,754
  2. Avatar for NotJim99 132. NotJim99 Lv 1 1 pt. 8,740
  3. Avatar for abiogenesis 133. abiogenesis Lv 1 1 pt. 8,720
  4. Avatar for ProfVince 134. ProfVince Lv 1 1 pt. 8,716
  5. Avatar for Simek 135. Simek Lv 1 1 pt. 8,697
  6. Avatar for kevin everington 136. kevin everington Lv 1 1 pt. 8,680
  7. Avatar for Racona Nova 137. Racona Nova Lv 1 1 pt. 8,646
  8. Avatar for Mickataef 138. Mickataef Lv 1 1 pt. 8,640
  9. Avatar for 81189h 139. 81189h Lv 1 1 pt. 8,616
  10. Avatar for pruneau_44 140. pruneau_44 Lv 1 1 pt. 8,605

Comments