Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for CHNO Junkies 11. CHNO Junkies 2 pts. 9,340
  2. Avatar for Russian team 12. Russian team 1 pt. 9,312
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,308
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,264
  5. Avatar for Kangwon_National_University_Computers_in_Chemistry 15. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,034
  6. Avatar for Chem Eng Thermo 16. Chem Eng Thermo 1 pt. 8,791
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 8,143
  8. Avatar for Deleted group 18. Deleted group pts. 7,553
  1. Avatar for NPrincipi 151. NPrincipi Lv 1 1 pt. 8,311
  2. Avatar for reich64 152. reich64 Lv 1 1 pt. 8,305
  3. Avatar for lunatik_2 153. lunatik_2 Lv 1 1 pt. 8,221
  4. Avatar for Altercomp 154. Altercomp Lv 1 1 pt. 8,162
  5. Avatar for fisherlr777 155. fisherlr777 Lv 1 1 pt. 8,154
  6. Avatar for fsk8r 156. fsk8r Lv 1 1 pt. 8,143
  7. Avatar for wontonsoup234 157. wontonsoup234 Lv 1 1 pt. 8,143
  8. Avatar for EagleGuy 158. EagleGuy Lv 1 1 pt. 8,124
  9. Avatar for pandapharmd 159. pandapharmd Lv 1 1 pt. 8,119
  10. Avatar for xabxs 160. xabxs Lv 1 1 pt. 8,112

Comments