Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for CHNO Junkies 11. CHNO Junkies 2 pts. 9,340
  2. Avatar for Russian team 12. Russian team 1 pt. 9,312
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,308
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,264
  5. Avatar for Chem Eng Thermo 16. Chem Eng Thermo 1 pt. 8,791
  6. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 8,143
  7. Avatar for Deleted group 18. Deleted group pts. 7,553

  1. Avatar for haggisfam 161. haggisfam Lv 1 1 pt. 8,097
  2. Avatar for judithhoh 162. judithhoh Lv 1 1 pt. 8,095
  3. Avatar for DScott 163. DScott Lv 1 1 pt. 8,079
  4. Avatar for GalacticNomad 164. GalacticNomad Lv 1 1 pt. 8,046
  5. Avatar for antibot215 165. antibot215 Lv 1 1 pt. 8,032
  6. Avatar for frostschutz 166. frostschutz Lv 1 1 pt. 7,981
  7. Avatar for Hum 167. Hum Lv 1 1 pt. 7,894
  8. Avatar for froschi2 168. froschi2 Lv 1 1 pt. 7,890
  9. Avatar for Pibeagles1 169. Pibeagles1 Lv 1 1 pt. 7,854
  10. Avatar for foldthestuffman 170. foldthestuffman Lv 1 1 pt. 7,756

Comments