Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for CHNO Junkies 11. CHNO Junkies 2 pts. 9,340
  2. Avatar for Russian team 12. Russian team 1 pt. 9,312
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,308
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,264
  5. Avatar for Kangwon_National_University_Computers_in_Chemistry 15. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,034
  6. Avatar for Chem Eng Thermo 16. Chem Eng Thermo 1 pt. 8,791
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 8,143
  8. Avatar for Deleted group 18. Deleted group pts. 7,553
  1. Avatar for 1b1s 171. 1b1s Lv 1 1 pt. 7,734
  2. Avatar for Pikamander2 172. Pikamander2 Lv 1 1 pt. 7,725
  3. Avatar for Orkman 173. Orkman Lv 1 1 pt. 7,664
  4. Avatar for awdrgy 174. awdrgy Lv 1 1 pt. 7,638
  5. Avatar for ja_ga 175. ja_ga Lv 1 1 pt. 7,634
  6. Avatar for evifnoskcaj 176. evifnoskcaj Lv 1 1 pt. 7,619
  7. Avatar for rene1010 177. rene1010 Lv 1 1 pt. 7,608
  8. Avatar for Thinlizard 178. Thinlizard Lv 1 1 pt. 7,604
  9. Avatar for YellowBearPL 179. YellowBearPL Lv 1 1 pt. 7,562
  10. Avatar for Gabrielle_D 180. Gabrielle_D Lv 1 1 pt. 7,553

Comments