Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for CHNO Junkies 11. CHNO Junkies 2 pts. 9,340
  2. Avatar for Russian team 12. Russian team 1 pt. 9,312
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,308
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,264
  5. Avatar for Kangwon_National_University_Computers_in_Chemistry 15. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,034
  6. Avatar for Chem Eng Thermo 16. Chem Eng Thermo 1 pt. 8,791
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 8,143
  8. Avatar for Deleted group 18. Deleted group pts. 7,553
  1. Avatar for malphis 11. malphis Lv 1 78 pts. 9,652
  2. Avatar for spmm 12. spmm Lv 1 76 pts. 9,649
  3. Avatar for fpc 13. fpc Lv 1 74 pts. 9,635
  4. Avatar for Phyx 14. Phyx Lv 1 72 pts. 9,633
  5. Avatar for CharlieFortsConscience 15. CharlieFortsConscience Lv 1 70 pts. 9,631
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 68 pts. 9,630
  7. Avatar for nicobul 17. nicobul Lv 1 67 pts. 9,624
  8. Avatar for MicElephant 18. MicElephant Lv 1 65 pts. 9,620
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 63 pts. 9,619
  10. Avatar for lynnai 20. lynnai Lv 1 62 pts. 9,616

Comments