Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for CHNO Junkies 11. CHNO Junkies 2 pts. 9,340
  2. Avatar for Russian team 12. Russian team 1 pt. 9,312
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,308
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,264
  5. Avatar for Kangwon_National_University_Computers_in_Chemistry 15. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,034
  6. Avatar for Chem Eng Thermo 16. Chem Eng Thermo 1 pt. 8,791
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 8,143
  8. Avatar for Deleted group 18. Deleted group pts. 7,553
  1. Avatar for fold_in_fold 191. fold_in_fold Lv 1 1 pt. 5,506
  2. Avatar for Weasibu 192. Weasibu Lv 1 1 pt. 5,501
  3. Avatar for Ufo_2012 193. Ufo_2012 Lv 1 1 pt. 5,488
  4. Avatar for jeffchen1014 194. jeffchen1014 Lv 1 1 pt. 5,454
  5. Avatar for devjosh 195. devjosh Lv 1 1 pt. 5,351
  6. Avatar for Nicolassicardroy 196. Nicolassicardroy Lv 1 1 pt. 5,351
  7. Avatar for SEF830 197. SEF830 Lv 1 1 pt. 5,351
  8. Avatar for Formula350 198. Formula350 Lv 1 1 pt. 5,351
  9. Avatar for ManVsYard 199. ManVsYard Lv 1 1 pt. 5,351
  10. Avatar for DoctorSockrates 200. DoctorSockrates Lv 1 1 pt. 5,351

Comments