Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for CHNO Junkies 11. CHNO Junkies 2 pts. 9,340
  2. Avatar for Russian team 12. Russian team 1 pt. 9,312
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,308
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,264
  5. Avatar for Kangwon_National_University_Computers_in_Chemistry 15. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,034
  6. Avatar for Chem Eng Thermo 16. Chem Eng Thermo 1 pt. 8,791
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 8,143
  8. Avatar for Deleted group 18. Deleted group pts. 7,553
  1. Avatar for Polarstern 21. Polarstern Lv 1 60 pts. 9,612
  2. Avatar for guineapig 22. guineapig Lv 1 58 pts. 9,604
  3. Avatar for cbwest 23. cbwest Lv 1 57 pts. 9,588
  4. Avatar for jobo0502 24. jobo0502 Lv 1 55 pts. 9,587
  5. Avatar for Deleted player 25. Deleted player pts. 9,586
  6. Avatar for georg137 26. georg137 Lv 1 52 pts. 9,577
  7. Avatar for Anfinsen_slept_here 27. Anfinsen_slept_here Lv 1 51 pts. 9,576
  8. Avatar for marsfan 28. marsfan Lv 1 49 pts. 9,572
  9. Avatar for g_b 29. g_b Lv 1 48 pts. 9,570
  10. Avatar for fiendish_ghoul 30. fiendish_ghoul Lv 1 47 pts. 9,560

Comments