Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for CHNO Junkies 11. CHNO Junkies 2 pts. 9,340
  2. Avatar for Russian team 12. Russian team 1 pt. 9,312
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,308
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,264
  5. Avatar for Kangwon_National_University_Computers_in_Chemistry 15. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,034
  6. Avatar for Chem Eng Thermo 16. Chem Eng Thermo 1 pt. 8,791
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 8,143
  8. Avatar for Deleted group 18. Deleted group pts. 7,553
  1. Avatar for pvc78 41. pvc78 Lv 1 34 pts. 9,496
  2. Avatar for drjr 42. drjr Lv 1 33 pts. 9,493
  3. Avatar for LastAndroid 43. LastAndroid Lv 1 32 pts. 9,488
  4. Avatar for inhtih 44. inhtih Lv 1 31 pts. 9,487
  5. Avatar for phi16 45. phi16 Lv 1 30 pts. 9,486
  6. Avatar for Blipperman 46. Blipperman Lv 1 29 pts. 9,476
  7. Avatar for OWM3 47. OWM3 Lv 1 28 pts. 9,475
  8. Avatar for WBarme1234 48. WBarme1234 Lv 1 27 pts. 9,471
  9. Avatar for spdenne 49. spdenne Lv 1 26 pts. 9,451
  10. Avatar for Lotus23 50. Lotus23 Lv 1 25 pts. 9,438

Comments