Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for CHNO Junkies 11. CHNO Junkies 2 pts. 9,340
  2. Avatar for Russian team 12. Russian team 1 pt. 9,312
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,308
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,264
  5. Avatar for Kangwon_National_University_Computers_in_Chemistry 15. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,034
  6. Avatar for Chem Eng Thermo 16. Chem Eng Thermo 1 pt. 8,791
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 8,143
  8. Avatar for Deleted group 18. Deleted group pts. 7,553
  1. Avatar for Hiro Protagonist 51. Hiro Protagonist Lv 1 25 pts. 9,437
  2. Avatar for Vincera 52. Vincera Lv 1 24 pts. 9,402
  3. Avatar for aendgraend 53. aendgraend Lv 1 23 pts. 9,394
  4. Avatar for Hustvedt 54. Hustvedt Lv 1 22 pts. 9,390
  5. Avatar for Timo van der Laan 55. Timo van der Laan Lv 1 22 pts. 9,378
  6. Avatar for heather-1 56. heather-1 Lv 1 21 pts. 9,377
  7. Avatar for argyrw 57. argyrw Lv 1 20 pts. 9,372
  8. Avatar for Norrjane 58. Norrjane Lv 1 20 pts. 9,371
  9. Avatar for Joanna_H 59. Joanna_H Lv 1 19 pts. 9,364
  10. Avatar for drumpeter18yrs9yrs 60. drumpeter18yrs9yrs Lv 1 18 pts. 9,359

Comments