Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for CHNO Junkies 11. CHNO Junkies 2 pts. 9,340
  2. Avatar for Russian team 12. Russian team 1 pt. 9,312
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,308
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,264
  5. Avatar for Kangwon_National_University_Computers_in_Chemistry 15. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,034
  6. Avatar for Chem Eng Thermo 16. Chem Eng Thermo 1 pt. 8,791
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 8,143
  8. Avatar for Deleted group 18. Deleted group pts. 7,553
  1. Avatar for jausmh 81. jausmh Lv 1 9 pts. 9,285
  2. Avatar for puxatudo 82. puxatudo Lv 1 8 pts. 9,273
  3. Avatar for aznarog 83. aznarog Lv 1 8 pts. 9,272
  4. Avatar for Todd6485577 84. Todd6485577 Lv 1 8 pts. 9,264
  5. Avatar for Beany 85. Beany Lv 1 7 pts. 9,241
  6. Avatar for Deleted player 86. Deleted player pts. 9,224
  7. Avatar for allie_heather47 87. allie_heather47 Lv 1 7 pts. 9,224
  8. Avatar for tangofox10 88. tangofox10 Lv 1 6 pts. 9,219
  9. Avatar for Merf 89. Merf Lv 1 6 pts. 9,218
  10. Avatar for rezaefar 90. rezaefar Lv 1 6 pts. 9,212

Comments