Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394
  1. Avatar for robgee 11. robgee Lv 1 9 pts. 9,728
  2. Avatar for phi16 12. phi16 Lv 1 7 pts. 9,724
  3. Avatar for fisherlr777 13. fisherlr777 Lv 1 5 pts. 9,722
  4. Avatar for pente_player 14. pente_player Lv 1 4 pts. 9,712
  5. Avatar for alcor29 15. alcor29 Lv 1 3 pts. 9,671
  6. Avatar for alwen 16. alwen Lv 1 2 pts. 9,657
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 1 pt. 9,646
  8. Avatar for georg137 18. georg137 Lv 1 1 pt. 9,637
  9. Avatar for puxatudo 19. puxatudo Lv 1 1 pt. 9,628
  10. Avatar for CharlieFortsConscience 20. CharlieFortsConscience Lv 1 1 pt. 9,574

Comments