Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Go Science 100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394

  1. Avatar for Jakki 91. Jakki Lv 1 6 pts. 9,190
  2. Avatar for jsfoldingaccount 92. jsfoldingaccount Lv 1 6 pts. 9,182
  3. Avatar for Arne Heessels 93. Arne Heessels Lv 1 5 pts. 9,175
  4. Avatar for Mohoernchen 94. Mohoernchen Lv 1 5 pts. 9,171
  5. Avatar for donuts554 95. donuts554 Lv 1 5 pts. 9,155
  6. Avatar for infjamc 96. infjamc Lv 1 5 pts. 9,146
  7. Avatar for CAN1958 97. CAN1958 Lv 1 4 pts. 9,125
  8. Avatar for rinze 98. rinze Lv 1 4 pts. 9,118
  9. Avatar for foobar23 99. foobar23 Lv 1 4 pts. 9,111
  10. Avatar for RWoodcock 100. RWoodcock Lv 1 4 pts. 9,097

Comments