Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Go Science 100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394

  1. Avatar for GuR0 101. GuR0 Lv 1 4 pts. 9,091
  2. Avatar for Dolichwier 102. Dolichwier Lv 1 4 pts. 9,084
  3. Avatar for Pazithi 103. Pazithi Lv 1 3 pts. 9,072
  4. Avatar for zeluis 104. zeluis Lv 1 3 pts. 9,060
  5. Avatar for BarrySampson 105. BarrySampson Lv 1 3 pts. 9,059
  6. Avatar for Dhalion 106. Dhalion Lv 1 3 pts. 9,053
  7. Avatar for jawz101 107. jawz101 Lv 1 3 pts. 9,053
  8. Avatar for 201512809 108. 201512809 Lv 1 3 pts. 9,034
  9. Avatar for FractalCuber 109. FractalCuber Lv 1 3 pts. 9,032
  10. Avatar for skovz99 110. skovz99 Lv 1 3 pts. 9,030

Comments