Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Go Science 100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394

  1. Avatar for RockOn 141. RockOn Lv 1 1 pt. 8,577
  2. Avatar for tzugypsyl 142. tzugypsyl Lv 1 1 pt. 8,517
  3. Avatar for peatw 143. peatw Lv 1 1 pt. 8,491
  4. Avatar for Alec_C 144. Alec_C Lv 1 1 pt. 8,484
  5. Avatar for Bucsan 145. Bucsan Lv 1 1 pt. 8,469
  6. Avatar for pasiphae 146. pasiphae Lv 1 1 pt. 8,431
  7. Avatar for Dr.Sillem 147. Dr.Sillem Lv 1 1 pt. 8,412
  8. Avatar for muffnerk 148. muffnerk Lv 1 1 pt. 8,398
  9. Avatar for Jaixmemly 149. Jaixmemly Lv 1 1 pt. 8,387
  10. Avatar for pangaena 150. pangaena Lv 1 1 pt. 8,377

Comments