Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Go Science 100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394

  1. Avatar for NPrincipi 151. NPrincipi Lv 1 1 pt. 8,311
  2. Avatar for reich64 152. reich64 Lv 1 1 pt. 8,305
  3. Avatar for lunatik_2 153. lunatik_2 Lv 1 1 pt. 8,221
  4. Avatar for Altercomp 154. Altercomp Lv 1 1 pt. 8,162
  5. Avatar for fisherlr777 155. fisherlr777 Lv 1 1 pt. 8,154
  6. Avatar for fsk8r 156. fsk8r Lv 1 1 pt. 8,143
  7. Avatar for wontonsoup234 157. wontonsoup234 Lv 1 1 pt. 8,143
  8. Avatar for EagleGuy 158. EagleGuy Lv 1 1 pt. 8,124
  9. Avatar for pandapharmd 159. pandapharmd Lv 1 1 pt. 8,119
  10. Avatar for xabxs 160. xabxs Lv 1 1 pt. 8,112

Comments