Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Go Science 100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394

  1. Avatar for haggisfam 161. haggisfam Lv 1 1 pt. 8,097
  2. Avatar for judithhoh 162. judithhoh Lv 1 1 pt. 8,095
  3. Avatar for DScott 163. DScott Lv 1 1 pt. 8,079
  4. Avatar for GalacticNomad 164. GalacticNomad Lv 1 1 pt. 8,046
  5. Avatar for antibot215 165. antibot215 Lv 1 1 pt. 8,032
  6. Avatar for frostschutz 166. frostschutz Lv 1 1 pt. 7,981
  7. Avatar for Hum 167. Hum Lv 1 1 pt. 7,894
  8. Avatar for froschi2 168. froschi2 Lv 1 1 pt. 7,890
  9. Avatar for Pibeagles1 169. Pibeagles1 Lv 1 1 pt. 7,854
  10. Avatar for foldthestuffman 170. foldthestuffman Lv 1 1 pt. 7,756

Comments