Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Go Science 100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394

  1. Avatar for 1b1s 171. 1b1s Lv 1 1 pt. 7,734
  2. Avatar for Pikamander2 172. Pikamander2 Lv 1 1 pt. 7,725
  3. Avatar for Orkman 173. Orkman Lv 1 1 pt. 7,664
  4. Avatar for awdrgy 174. awdrgy Lv 1 1 pt. 7,638
  5. Avatar for ja_ga 175. ja_ga Lv 1 1 pt. 7,634
  6. Avatar for evifnoskcaj 176. evifnoskcaj Lv 1 1 pt. 7,619
  7. Avatar for rene1010 177. rene1010 Lv 1 1 pt. 7,608
  8. Avatar for Thinlizard 178. Thinlizard Lv 1 1 pt. 7,604
  9. Avatar for YellowBearPL 179. YellowBearPL Lv 1 1 pt. 7,562
  10. Avatar for Gabrielle_D 180. Gabrielle_D Lv 1 1 pt. 7,553

Comments