Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Go Science 100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394

  1. Avatar for malphis 11. malphis Lv 1 78 pts. 9,652
  2. Avatar for spmm 12. spmm Lv 1 76 pts. 9,649
  3. Avatar for fpc 13. fpc Lv 1 74 pts. 9,635
  4. Avatar for Phyx 14. Phyx Lv 1 72 pts. 9,633
  5. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 68 pts. 9,630
  6. Avatar for nicobul 17. nicobul Lv 1 67 pts. 9,624
  7. Avatar for MicElephant 18. MicElephant Lv 1 65 pts. 9,620
  8. Avatar for dcrwheeler 19. dcrwheeler Lv 1 63 pts. 9,619
  9. Avatar for lynnai 20. lynnai Lv 1 62 pts. 9,616

Comments