Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Go Science 100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394

  1. Avatar for fold_in_fold 191. fold_in_fold Lv 1 1 pt. 5,506
  2. Avatar for Weasibu 192. Weasibu Lv 1 1 pt. 5,501
  3. Avatar for Ufo_2012 193. Ufo_2012 Lv 1 1 pt. 5,488
  4. Avatar for jeffchen1014 194. jeffchen1014 Lv 1 1 pt. 5,454
  5. Avatar for devjosh 195. devjosh Lv 1 1 pt. 5,351
  6. Avatar for Nicolassicardroy 196. Nicolassicardroy Lv 1 1 pt. 5,351
  7. Avatar for SEF830 197. SEF830 Lv 1 1 pt. 5,351
  8. Avatar for Formula350 198. Formula350 Lv 1 1 pt. 5,351
  9. Avatar for ManVsYard 199. ManVsYard Lv 1 1 pt. 5,351
  10. Avatar for DoctorSockrates 200. DoctorSockrates Lv 1 1 pt. 5,351

Comments