Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Go Science 100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394

  1. Avatar for Polarstern 21. Polarstern Lv 1 60 pts. 9,612
  2. Avatar for guineapig 22. guineapig Lv 1 58 pts. 9,604
  3. Avatar for cbwest 23. cbwest Lv 1 57 pts. 9,588
  4. Avatar for jobo0502 24. jobo0502 Lv 1 55 pts. 9,587
  5. Avatar for Deleted player 25. Deleted player pts. 9,586
  6. Avatar for georg137 26. georg137 Lv 1 52 pts. 9,577
  7. Avatar for Anfinsen_slept_here 27. Anfinsen_slept_here Lv 1 51 pts. 9,576
  8. Avatar for marsfan 28. marsfan Lv 1 49 pts. 9,572
  9. Avatar for g_b 29. g_b Lv 1 48 pts. 9,570
  10. Avatar for fiendish_ghoul 30. fiendish_ghoul Lv 1 47 pts. 9,560

Comments