Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Go Science 100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394

  1. Avatar for pvc78 41. pvc78 Lv 1 34 pts. 9,496
  2. Avatar for drjr 42. drjr Lv 1 33 pts. 9,493
  3. Avatar for LastAndroid 43. LastAndroid Lv 1 32 pts. 9,488
  4. Avatar for inhtih 44. inhtih Lv 1 31 pts. 9,487
  5. Avatar for phi16 45. phi16 Lv 1 30 pts. 9,486
  6. Avatar for Blipperman 46. Blipperman Lv 1 29 pts. 9,476
  7. Avatar for OWM3 47. OWM3 Lv 1 28 pts. 9,475
  8. Avatar for WBarme1234 48. WBarme1234 Lv 1 27 pts. 9,471
  9. Avatar for spdenne 49. spdenne Lv 1 26 pts. 9,451
  10. Avatar for Lotus23 50. Lotus23 Lv 1 25 pts. 9,438

Comments