Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Go Science 100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394

  1. Avatar for Hiro Protagonist 51. Hiro Protagonist Lv 1 25 pts. 9,437
  2. Avatar for Vincera 52. Vincera Lv 1 24 pts. 9,402
  3. Avatar for aendgraend 53. aendgraend Lv 1 23 pts. 9,394
  4. Avatar for Hustvedt 54. Hustvedt Lv 1 22 pts. 9,390
  5. Avatar for Timo van der Laan 55. Timo van der Laan Lv 1 22 pts. 9,378
  6. Avatar for heather-1 56. heather-1 Lv 1 21 pts. 9,377
  7. Avatar for argyrw 57. argyrw Lv 1 20 pts. 9,372
  8. Avatar for Norrjane 58. Norrjane Lv 1 20 pts. 9,371
  9. Avatar for Joanna_H 59. Joanna_H Lv 1 19 pts. 9,364
  10. Avatar for drumpeter18yrs9yrs 60. drumpeter18yrs9yrs Lv 1 18 pts. 9,359

Comments