Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394
  1. Avatar for Rukh 181. Rukh Lv 1 1 pt. 7,523
  2. Avatar for harvardman 182. harvardman Lv 1 1 pt. 7,445
  3. Avatar for mOn12345 183. mOn12345 Lv 1 1 pt. 7,417
  4. Avatar for Corruption 184. Corruption Lv 1 1 pt. 7,325
  5. Avatar for Kunfa 185. Kunfa Lv 1 1 pt. 7,293
  6. Avatar for mwm64 186. mwm64 Lv 1 1 pt. 7,231
  7. Avatar for HMK 187. HMK Lv 1 1 pt. 7,151
  8. Avatar for Ricardo Oliveira 188. Ricardo Oliveira Lv 1 1 pt. 7,022
  9. Avatar for 01010011111 189. 01010011111 Lv 1 1 pt. 6,854
  10. Avatar for karmena 190. karmena Lv 1 1 pt. 6,262

Comments