Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 10,601
  2. Avatar for Marvin's bunch 12. Marvin's bunch 3 pts. 10,425
  3. Avatar for Russian team 13. Russian team 2 pts. 10,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 10,190
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 10,119
  6. Avatar for Kangwon_National_University_Computers_in_Chemistry 16. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,362
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 9,248
  8. Avatar for Team China 18. Team China 1 pt. 9,048
  9. Avatar for Trinity Biology 19. Trinity Biology 1 pt. 8,907
  10. Avatar for CHNO Junkies 20. CHNO Junkies 1 pt. 8,696
  1. Avatar for jawz101 111. jawz101 Lv 1 2 pts. 9,799
  2. Avatar for zo3xiaJonWeinberg 112. zo3xiaJonWeinberg Lv 1 2 pts. 9,788
  3. Avatar for alcor29 113. alcor29 Lv 1 2 pts. 9,768
  4. Avatar for Czim 114. Czim Lv 1 2 pts. 9,766
  5. Avatar for pente_player 115. pente_player Lv 1 2 pts. 9,754
  6. Avatar for Arne Heessels 116. Arne Heessels Lv 1 2 pts. 9,745
  7. Avatar for nathalie friess salido 117. nathalie friess salido Lv 1 2 pts. 9,714
  8. Avatar for tom2705 118. tom2705 Lv 1 2 pts. 9,699
  9. Avatar for rabamino12358 119. rabamino12358 Lv 1 2 pts. 9,684
  10. Avatar for felixxy 120. felixxy Lv 1 2 pts. 9,662

Comments