Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,569
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 79 pts. 11,077
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 11,041
  4. Avatar for Contenders 4. Contenders 47 pts. 11,024
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 10,972
  6. Avatar for Beta Folders 6. Beta Folders 26 pts. 10,954
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 10,914
  8. Avatar for Hold My Beer 8. Hold My Beer 14 pts. 10,792
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,659
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 7 pts. 10,610
  1. Avatar for jawz101 111. jawz101 Lv 1 2 pts. 9,799
  2. Avatar for zo3xiaJonWeinberg 112. zo3xiaJonWeinberg Lv 1 2 pts. 9,788
  3. Avatar for alcor29 113. alcor29 Lv 1 2 pts. 9,768
  4. Avatar for Czim 114. Czim Lv 1 2 pts. 9,766
  5. Avatar for pente_player 115. pente_player Lv 1 2 pts. 9,754
  6. Avatar for Arne Heessels 116. Arne Heessels Lv 1 2 pts. 9,745
  7. Avatar for nathalie friess salido 117. nathalie friess salido Lv 1 2 pts. 9,714
  8. Avatar for tom2705 118. tom2705 Lv 1 2 pts. 9,699
  9. Avatar for rabamino12358 119. rabamino12358 Lv 1 2 pts. 9,684
  10. Avatar for felixxy 120. felixxy Lv 1 2 pts. 9,662

Comments