Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,106
  2. Avatar for Biochemistry-I-CSolisC 1 22. Biochemistry-I-CSolisC 1 1 pt. 0
  1. Avatar for malphis 11. malphis Lv 1 78 pts. 10,991
  2. Avatar for silent gene 12. silent gene Lv 1 76 pts. 10,972
  3. Avatar for grogar7 13. grogar7 Lv 1 74 pts. 10,966
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 72 pts. 10,958
  5. Avatar for Galaxie 15. Galaxie Lv 1 70 pts. 10,954
  6. Avatar for spmm 16. spmm Lv 1 68 pts. 10,946
  7. Avatar for Deleted player 17. Deleted player 67 pts. 10,946
  8. Avatar for Susume 18. Susume Lv 1 65 pts. 10,943
  9. Avatar for RockOn 19. RockOn Lv 1 63 pts. 10,926
  10. Avatar for LastAndroid 20. LastAndroid Lv 1 62 pts. 10,913

Comments