Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups



  1. Avatar for jobo0502 21. jobo0502 Lv 1 60 pts. 10,905
  2. Avatar for pauldunn 22. pauldunn Lv 1 58 pts. 10,904
  3. Avatar for John McLeod 23. John McLeod Lv 1 57 pts. 10,904
  4. Avatar for mirp 24. mirp Lv 1 55 pts. 10,896
  5. Avatar for LociOiling 25. LociOiling Lv 1 54 pts. 10,890
  6. Avatar for NinjaGreg 26. NinjaGreg Lv 1 52 pts. 10,879
  7. Avatar for ZeroLeak7 27. ZeroLeak7 Lv 1 51 pts. 10,862
  8. Avatar for Blipperman 28. Blipperman Lv 1 49 pts. 10,856
  9. Avatar for Polarstern 29. Polarstern Lv 1 48 pts. 10,850
  10. Avatar for robgee 30. robgee Lv 1 47 pts. 10,838

Comments