Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups



  1. Avatar for actiasluna 41. actiasluna Lv 1 34 pts. 10,719
  2. Avatar for georg137 42. georg137 Lv 1 33 pts. 10,707
  3. Avatar for GuR0 43. GuR0 Lv 1 32 pts. 10,704
  4. Avatar for guineapig 44. guineapig Lv 1 31 pts. 10,695
  5. Avatar for diamonddays 45. diamonddays Lv 1 30 pts. 10,686
  6. Avatar for Deleted player 46. Deleted player pts. 10,685
  7. Avatar for argyrw 47. argyrw Lv 1 28 pts. 10,675
  8. Avatar for aznarog 48. aznarog Lv 1 27 pts. 10,668
  9. Avatar for O Seki To 49. O Seki To Lv 1 26 pts. 10,659
  10. Avatar for ichwilldiesennamen 50. ichwilldiesennamen Lv 1 25 pts. 10,648

Comments