Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups



  1. Avatar for inhtih 51. inhtih Lv 1 25 pts. 10,647
  2. Avatar for Tygh 52. Tygh Lv 1 24 pts. 10,646
  3. Avatar for Todd6485577 53. Todd6485577 Lv 1 23 pts. 10,617
  4. Avatar for Hiro Protagonist 54. Hiro Protagonist Lv 1 22 pts. 10,610
  5. Avatar for pmthomson90 55. pmthomson90 Lv 1 22 pts. 10,601
  6. Avatar for Anfinsen_slept_here 56. Anfinsen_slept_here Lv 1 21 pts. 10,575
  7. Avatar for MicElephant 57. MicElephant Lv 1 20 pts. 10,564
  8. Avatar for ManVsYard 58. ManVsYard Lv 1 20 pts. 10,525
  9. Avatar for BarrySampson 59. BarrySampson Lv 1 19 pts. 10,524
  10. Avatar for Lotus23 60. Lotus23 Lv 1 18 pts. 10,506

Comments