Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups



  1. Avatar for Merf 61. Merf Lv 1 18 pts. 10,484
  2. Avatar for fpc 62. fpc Lv 1 17 pts. 10,425
  3. Avatar for Hustvedt 63. Hustvedt Lv 1 16 pts. 10,406
  4. Avatar for WBarme1234 64. WBarme1234 Lv 1 16 pts. 10,385
  5. Avatar for heather-1 65. heather-1 Lv 1 15 pts. 10,383
  6. Avatar for rezaefar 66. rezaefar Lv 1 15 pts. 10,379
  7. Avatar for lraguette 67. lraguette Lv 1 14 pts. 10,340
  8. Avatar for SKSbell 68. SKSbell Lv 1 14 pts. 10,334
  9. Avatar for tangofox10 69. tangofox10 Lv 1 13 pts. 10,325

Comments