Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups



  1. Avatar for abiogenesis 71. abiogenesis Lv 1 12 pts. 10,276
  2. Avatar for jausmh 72. jausmh Lv 1 12 pts. 10,274
  3. Avatar for donuts554 73. donuts554 Lv 1 12 pts. 10,269
  4. Avatar for FractalCuber 74. FractalCuber Lv 1 11 pts. 10,262
  5. Avatar for MrZanav 75. MrZanav Lv 1 11 pts. 10,255
  6. Avatar for Pikkachurin 76. Pikkachurin Lv 1 10 pts. 10,252
  7. Avatar for hansvandenhof 77. hansvandenhof Lv 1 10 pts. 10,246
  8. Avatar for cbwest 78. cbwest Lv 1 10 pts. 10,228
  9. Avatar for kyoota 79. kyoota Lv 1 9 pts. 10,218
  10. Avatar for pvc78 80. pvc78 Lv 1 9 pts. 10,206

Comments