Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups



  1. Avatar for Philzord 81. Philzord Lv 1 9 pts. 10,195
  2. Avatar for ShadowTactics 82. ShadowTactics Lv 1 8 pts. 10,190
  3. Avatar for Pawel Tluscik 83. Pawel Tluscik Lv 1 8 pts. 10,143
  4. Avatar for stomjoh 84. stomjoh Lv 1 8 pts. 10,120
  5. Avatar for aendgraend 85. aendgraend Lv 1 7 pts. 10,119
  6. Avatar for infjamc 86. infjamc Lv 1 7 pts. 10,101
  7. Avatar for spdenne 87. spdenne Lv 1 7 pts. 10,094
  8. Avatar for spvincent 88. spvincent Lv 1 6 pts. 10,084
  9. Avatar for Formula350 89. Formula350 Lv 1 6 pts. 10,071
  10. Avatar for ComputerMage 90. ComputerMage Lv 1 6 pts. 10,059

Comments