Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,569
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 79 pts. 11,077
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 11,041
  4. Avatar for Contenders 4. Contenders 47 pts. 11,024
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 10,972
  6. Avatar for Beta Folders 6. Beta Folders 26 pts. 10,954
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 10,914
  8. Avatar for Hold My Beer 8. Hold My Beer 14 pts. 10,792
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,659
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 7 pts. 10,610
  1. Avatar for kevin everington 151. kevin everington Lv 1 1 pt. 9,303
  2. Avatar for pasiphae 152. pasiphae Lv 1 1 pt. 9,302
  3. Avatar for pangaena 153. pangaena Lv 1 1 pt. 9,295
  4. Avatar for skovz99 154. skovz99 Lv 1 1 pt. 9,289
  5. Avatar for AlkiP0Ps 155. AlkiP0Ps Lv 1 1 pt. 9,277
  6. Avatar for Dr.Sillem 156. Dr.Sillem Lv 1 1 pt. 9,262
  7. Avatar for abskebabs 157. abskebabs Lv 1 1 pt. 9,257
  8. Avatar for MaxR4 158. MaxR4 Lv 1 1 pt. 9,254
  9. Avatar for wontonsoup234 159. wontonsoup234 Lv 1 1 pt. 9,248
  10. Avatar for lconor 160. lconor Lv 1 1 pt. 9,240

Comments