Placeholder image of a protein
Icon representing a puzzle

1863: Refinement Puzzle: R1043

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 09, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


SFEEQFIKNNSDSNILAPKVSQSVIKSIKGIKSKHVFELPINDKTKRYILGATETKEEVLPNYVKVGSDLYRLKAYREKSGVYVRTNKLGFEDPKSFLSIKEYKFGTRTGGNFTGELTKQELVYTNQWVNENITLANGYISADSRTVD

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,871
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 10,782
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 10,723
  4. Avatar for Deleted group 14. Deleted group pts. 10,709
  5. Avatar for GBHS BMAH kids 15. GBHS BMAH kids 1 pt. 10,648
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 10,640
  7. Avatar for Mojo Risin' 17. Mojo Risin' 1 pt. 10,402

  1. Avatar for YJTocre 131. YJTocre Lv 1 1 pt. 10,048
  2. Avatar for zeluis 132. zeluis Lv 1 1 pt. 9,993
  3. Avatar for justjustin 133. justjustin Lv 1 1 pt. 9,975
  4. Avatar for Fotis Papas 134. Fotis Papas Lv 1 1 pt. 9,942
  5. Avatar for jawz101 135. jawz101 Lv 1 1 pt. 9,910
  6. Avatar for Hellcat6 136. Hellcat6 Lv 1 1 pt. 9,902
  7. Avatar for Dr.Sillem 137. Dr.Sillem Lv 1 1 pt. 9,894
  8. Avatar for NPrincipi 138. NPrincipi Lv 1 1 pt. 9,884
  9. Avatar for akdptmxmfh2 139. akdptmxmfh2 Lv 1 1 pt. 9,869
  10. Avatar for tom2705 140. tom2705 Lv 1 1 pt. 9,861

Comments


LociOiling Lv 1

Seeing a lot of crashes using remix on devprev. Rebuild doesn't seem quite as touchy, but I did get a rebuild crash.

Lots of debug.txts getting generated. Most seem to have a double stack trace, but there's no usable information I can see.