Placeholder image of a protein
Icon representing a puzzle

1863: Refinement Puzzle: R1043

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 09, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


SFEEQFIKNNSDSNILAPKVSQSVIKSIKGIKSKHVFELPINDKTKRYILGATETKEEVLPNYVKVGSDLYRLKAYREKSGVYVRTNKLGFEDPKSFLSIKEYKFGTRTGGNFTGELTKQELVYTNQWVNENITLANGYISADSRTVD

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,871
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 10,782
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 10,723
  4. Avatar for Deleted group 14. Deleted group pts. 10,709
  5. Avatar for GBHS BMAH kids 15. GBHS BMAH kids 1 pt. 10,648
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 10,640
  7. Avatar for Mojo Risin' 17. Mojo Risin' 1 pt. 10,402
  1. Avatar for Deleted player 21. Deleted player 56 pts. 11,661
  2. Avatar for silent gene 22. silent gene Lv 1 54 pts. 11,652
  3. Avatar for Todd6485577 23. Todd6485577 Lv 1 52 pts. 11,632
  4. Avatar for pvc78 24. pvc78 Lv 1 51 pts. 11,608
  5. Avatar for Blipperman 25. Blipperman Lv 1 49 pts. 11,593
  6. Avatar for georg137 26. georg137 Lv 1 47 pts. 11,592
  7. Avatar for LastAndroid 27. LastAndroid Lv 1 46 pts. 11,587
  8. Avatar for guineapig 28. guineapig Lv 1 44 pts. 11,570
  9. Avatar for Tygh 29. Tygh Lv 1 43 pts. 11,568
  10. Avatar for jobo0502 30. jobo0502 Lv 1 42 pts. 11,565

Comments

LociOiling Lv 1

Seeing a lot of crashes using remix on devprev. Rebuild doesn't seem quite as touchy, but I did get a rebuild crash.

Lots of debug.txts getting generated. Most seem to have a double stack trace, but there's no usable information I can see.