Placeholder image of a protein
Icon representing a puzzle

1863: Refinement Puzzle: R1043

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 09, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


SFEEQFIKNNSDSNILAPKVSQSVIKSIKGIKSKHVFELPINDKTKRYILGATETKEEVLPNYVKVGSDLYRLKAYREKSGVYVRTNKLGFEDPKSFLSIKEYKFGTRTGGNFTGELTKQELVYTNQWVNENITLANGYISADSRTVD

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,871
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 10,782
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 10,723
  4. Avatar for Deleted group 14. Deleted group pts. 10,709
  5. Avatar for GBHS BMAH kids 15. GBHS BMAH kids 1 pt. 10,648
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 10,640
  7. Avatar for Mojo Risin' 17. Mojo Risin' 1 pt. 10,402

  1. Avatar for tangofox10 41. tangofox10 Lv 1 29 pts. 11,445
  2. Avatar for WBarme1234 42. WBarme1234 Lv 1 28 pts. 11,442
  3. Avatar for Alistair69 43. Alistair69 Lv 1 27 pts. 11,438
  4. Avatar for Anfinsen_slept_here 44. Anfinsen_slept_here Lv 1 26 pts. 11,433
  5. Avatar for Formula350 45. Formula350 Lv 1 25 pts. 11,414
  6. Avatar for BootsMcGraw 46. BootsMcGraw Lv 1 24 pts. 11,406
  7. Avatar for MrZanav 47. MrZanav Lv 1 23 pts. 11,383
  8. Avatar for abiogenesis 48. abiogenesis Lv 1 22 pts. 11,380
  9. Avatar for alcor29 49. alcor29 Lv 1 21 pts. 11,361
  10. Avatar for lraguette 50. lraguette Lv 1 20 pts. 11,324

Comments


LociOiling Lv 1

Seeing a lot of crashes using remix on devprev. Rebuild doesn't seem quite as touchy, but I did get a rebuild crash.

Lots of debug.txts getting generated. Most seem to have a double stack trace, but there's no usable information I can see.