Placeholder image of a protein
Icon representing a puzzle

1863: Refinement Puzzle: R1043

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 09, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


SFEEQFIKNNSDSNILAPKVSQSVIKSIKGIKSKHVFELPINDKTKRYILGATETKEEVLPNYVKVGSDLYRLKAYREKSGVYVRTNKLGFEDPKSFLSIKEYKFGTRTGGNFTGELTKQELVYTNQWVNENITLANGYISADSRTVD

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,871
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 10,782
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 10,723
  4. Avatar for Deleted group 14. Deleted group pts. 10,709
  5. Avatar for GBHS BMAH kids 15. GBHS BMAH kids 1 pt. 10,648
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 10,640
  7. Avatar for Mojo Risin' 17. Mojo Risin' 1 pt. 10,402

  1. Avatar for Susume 51. Susume Lv 1 20 pts. 11,314
  2. Avatar for donuts554 52. donuts554 Lv 1 19 pts. 11,282
  3. Avatar for g_b 53. g_b Lv 1 18 pts. 11,256
  4. Avatar for manu8170 54. manu8170 Lv 1 18 pts. 11,250
  5. Avatar for Deleted player 55. Deleted player pts. 11,246
  6. Avatar for kyoota 56. kyoota Lv 1 16 pts. 11,233
  7. Avatar for joremen 57. joremen Lv 1 16 pts. 11,228
  8. Avatar for Dhalion 58. Dhalion Lv 1 15 pts. 11,194
  9. Avatar for diamonddays 59. diamonddays Lv 1 14 pts. 11,192
  10. Avatar for xabxs 60. xabxs Lv 1 14 pts. 11,170

Comments


LociOiling Lv 1

Seeing a lot of crashes using remix on devprev. Rebuild doesn't seem quite as touchy, but I did get a rebuild crash.

Lots of debug.txts getting generated. Most seem to have a double stack trace, but there's no usable information I can see.