Placeholder image of a protein
Icon representing a puzzle

1863: Refinement Puzzle: R1043

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 09, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


SFEEQFIKNNSDSNILAPKVSQSVIKSIKGIKSKHVFELPINDKTKRYILGATETKEEVLPNYVKVGSDLYRLKAYREKSGVYVRTNKLGFEDPKSFLSIKEYKFGTRTGGNFTGELTKQELVYTNQWVNENITLANGYISADSRTVD

Top groups


  1. Avatar for Go Science 100 pts. 12,073
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 11,938
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 11,870
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 11,846
  5. Avatar for Contenders 5. Contenders 24 pts. 11,815
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 11,724
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,640
  8. Avatar for Hold My Beer 8. Hold My Beer 6 pts. 11,632
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 11,451
  10. Avatar for Russian team 10. Russian team 2 pts. 11,233

  1. Avatar for HMK 151. HMK Lv 1 1 pt. 9,731
  2. Avatar for AlkiP0Ps 152. AlkiP0Ps Lv 1 1 pt. 9,727
  3. Avatar for 9racoon 153. 9racoon Lv 1 1 pt. 9,685
  4. Avatar for fishercat 154. fishercat Lv 1 1 pt. 9,649
  5. Avatar for Barium56 155. Barium56 Lv 1 1 pt. 9,608
  6. Avatar for zannipietro 156. zannipietro Lv 1 1 pt. 9,604
  7. Avatar for oganesson 157. oganesson Lv 1 1 pt. 9,527
  8. Avatar for molleke 158. molleke Lv 1 1 pt. 9,474
  9. Avatar for harvardman 159. harvardman Lv 1 1 pt. 9,237

Comments


LociOiling Lv 1

Seeing a lot of crashes using remix on devprev. Rebuild doesn't seem quite as touchy, but I did get a rebuild crash.

Lots of debug.txts getting generated. Most seem to have a double stack trace, but there's no usable information I can see.