Placeholder image of a protein
Icon representing a puzzle

1863: Refinement Puzzle: R1043

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 09, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


SFEEQFIKNNSDSNILAPKVSQSVIKSIKGIKSKHVFELPINDKTKRYILGATETKEEVLPNYVKVGSDLYRLKAYREKSGVYVRTNKLGFEDPKSFLSIKEYKFGTRTGGNFTGELTKQELVYTNQWVNENITLANGYISADSRTVD

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,073
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 11,938
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 11,870
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 11,846
  5. Avatar for Contenders 5. Contenders 24 pts. 11,815
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 11,724
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,640
  8. Avatar for Hold My Beer 8. Hold My Beer 6 pts. 11,632
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 11,451
  10. Avatar for Russian team 10. Russian team 2 pts. 11,233
  1. Avatar for Puttering 161. Puttering Lv 1 1 pt. 9,113
  2. Avatar for SKSbell 162. SKSbell Lv 1 1 pt. 9,112
  3. Avatar for CAN1958 163. CAN1958 Lv 1 1 pt. 9,072
  4. Avatar for serg-on 164. serg-on Lv 1 1 pt. 8,761
  5. Avatar for lopesteves 165. lopesteves Lv 1 1 pt. 8,644
  6. Avatar for bkoep 166. bkoep Lv 1 1 pt. 8,519
  7. Avatar for aka_bkoep 167. aka_bkoep Lv 1 1 pt. 8,519
  8. Avatar for kucharz 168. kucharz Lv 1 1 pt. 8,519
  9. Avatar for marsfan 169. marsfan Lv 1 1 pt. 8,519
  10. Avatar for Scopper 170. Scopper Lv 1 1 pt. 8,519

Comments

LociOiling Lv 1

Seeing a lot of crashes using remix on devprev. Rebuild doesn't seem quite as touchy, but I did get a rebuild crash.

Lots of debug.txts getting generated. Most seem to have a double stack trace, but there's no usable information I can see.