Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 3 pts. 9,803
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,778
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,398
  4. Avatar for Australia 14. Australia 1 pt. 9,378
  5. Avatar for Team Canada 15. Team Canada 1 pt. 9,298
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 8,973
  7. Avatar for Deleted group 17. Deleted group pts. 8,818
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,793
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 8,441
  10. Avatar for Deleted group 20. Deleted group pts. 7,953

  1. Avatar for puxatudo 111. puxatudo Lv 1 1 pt. 9,161
  2. Avatar for xbp 112. xbp Lv 1 1 pt. 9,137
  3. Avatar for SHK5P 113. SHK5P Lv 1 1 pt. 9,079
  4. Avatar for Mike Cassidy 114. Mike Cassidy Lv 1 1 pt. 9,044
  5. Avatar for Jakki 115. Jakki Lv 1 1 pt. 9,012
  6. Avatar for pfirth 116. pfirth Lv 1 1 pt. 9,010
  7. Avatar for Dr.Sillem 117. Dr.Sillem Lv 1 1 pt. 9,006
  8. Avatar for Tlaloc 118. Tlaloc Lv 1 1 pt. 8,973
  9. Avatar for badgoes 119. badgoes Lv 1 1 pt. 8,936
  10. Avatar for roman madala 120. roman madala Lv 1 1 pt. 8,911

Comments